"event" : "removeMessageUserEmailSubscription", "action" : "pulsate" "event" : "removeThreadUserEmailSubscription", ;(function($) { "context" : "", { "action" : "rerender" "action" : "rerender" { ] "action" : "rerender" { "action" : "rerender" "event" : "unapproveMessage", } { { "action" : "rerender" "action" : "rerender" event.preventDefault(); "actions" : [ "context" : "", } "action" : "pulsate" { { }, "action" : "rerender" "displaySubject" : "true", { } else { var o = document.getElementById("custom_board_pagination_warning" + pagerId); Ich weiß bis heute nicht wie es zu dem Abo kommen konnte. "; }, { { "event" : "MessagesWidgetAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_30","feedbackSelector":".InfoMessage"}); { }, }); "actions" : [ "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); "message" : "2046203", "event" : "addThreadUserEmailSubscription", ] "action" : "rerender" }, { }, }, return false; LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "actions" : [ ] "revokeMode" : "true", "action" : "rerender" if ( watching ) { "event" : "expandMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); { document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); "actions" : [ "action" : "rerender" "event" : "addMessageUserEmailSubscription", "actions" : [ "actions" : [ "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/83961","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cttSCttqeS39PRaSmm9GKKrkBwb9PGmb0AYbPDrwbQI. LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); lithstudio: [], LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); Maestro-Karte sofort entweder von Ihrem Girokonto abgebucht wird oder ihrem Kreditkartenkonto belastet wird. $(this).next().toggle(); }, "context" : "", } }, "context" : "", "messageViewOptions" : "1111110111111111111110111110100101001101" "showCountOnly" : "false", "event" : "MessagesWidgetEditCommentForm", }, ] "actions" : [ }, "action" : "rerender" "disableKudosForAnonUser" : "false", }, "context" : "envParam:quiltName", "actions" : [ ] "actions" : [ } "action" : "rerender" { "kudosable" : "true", } "event" : "ProductAnswerComment", $('#node-menu li.has-sub>a').on('click', function(){ "action" : "rerender" CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "context" : "lia-deleted-state", ;(function($) { "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", "context" : "", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/83961","ajaxErrorEventName":"LITHIUM:ajaxError","token":"mPTaG3JRQRiHVzdQ0a9_2ks4Odrf7TbdvJyuMV0HDpM. { { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "closeEvent" : "LITHIUM:lightboxCloseEvent", ] } "event" : "expandMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); $(this).next().toggle(); "context" : "", "actions" : [ "componentId" : "forums.widget.message-view", }, "context" : "", "actions" : [ { { "componentId" : "forums.widget.message-view", { }, ] "event" : "MessagesWidgetEditCommentForm", "actions" : [ var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "action" : "rerender" "event" : "MessagesWidgetMessageEdit", }, }, ] { ', 'ajax'); ] Eine Alternative Lösung zu Charge, Debit und Credit Card bietet die Prepaid Card. /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] "action" : "rerender" "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "selector" : "#messageview_0", "event" : "addThreadUserEmailSubscription", }, "action" : "rerender" }, ] } { { { "parameters" : { "actions" : [ { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { { "message" : "2046183", "disallowZeroCount" : "false", "action" : "rerender" "showCountOnly" : "false", { "action" : "rerender" "triggerEvent" : "click", "action" : "rerender" { "event" : "MessagesWidgetCommentForm", "action" : "rerender" { "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAnswerForm", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); "parameters" : { "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "envParam:quiltName,expandedQuiltName", { "message" : "2045283", "action" : "rerender" }, "event" : "deleteMessage", return true; { }, "actions" : [ "truncateBodyRetainsHtml" : "false", } { } } element.addClass('active'); "disableLinks" : "false", "action" : "addClassName" }, "actions" : [ setWarning(pagerId); ], } LITHIUM.Dialog({ "context" : "", { "event" : "markAsSpamWithoutRedirect", "action" : "rerender" ] LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } ] "event" : "MessagesWidgetEditAnswerForm", ] "event" : "removeThreadUserEmailSubscription", } }, LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "MessagesWidgetAnswerForm", "actions" : [ document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div"); "actions" : [ // Set start to true only if the first key in the sequence is pressed "context" : "", "action" : "rerender" "action" : "rerender" "kudosLinksDisabled" : "false", } if (val.trim() == "") { "truncateBodyRetainsHtml" : "false", }, "event" : "addThreadUserEmailSubscription", "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "MessagesWidgetAnswerForm", ] "event" : "addMessageUserEmailSubscription", "useCountToKudo" : "false", { "context" : "", "event" : "unapproveMessage", ] "event" : "deleteMessage", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); } "displaySubject" : "true", "action" : "rerender" "action" : "rerender" "kudosLinksDisabled" : "false", "context" : "envParam:entity", "revokeMode" : "true", { "context" : "lia-deleted-state", "action" : "rerender" } LITHIUM.AjaxSupport.ComponentEvents.set({ }, } } { { { ], "actions" : [ { }, ] ] { "actions" : [ } "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "ProductMessageEdit", { "event" : "deleteMessage", "; ] function setWarning(pagerId) { ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "RevokeSolutionAction", { "truncateBodyRetainsHtml" : "false", }, "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "action" : "rerender" Viele Nutzer des Bezahldienstes Paypal melden, dass es auf ihrem Konto unberechtigte Abbuchungen gegeben hat. "actions" : [ "event" : "MessagesWidgetCommentForm", { }, // just for convenience, you need a login anyways... "event" : "removeThreadUserEmailSubscription", ] { "actions" : [ "event" : "approveMessage", "selector" : "#messageview_7", "eventActions" : [ "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "context" : "lia-deleted-state", "selector" : "#kudosButtonV2_8", "messageViewOptions" : "1111110111111111111110111110100101001101" "componentId" : "kudos.widget.button", var watching = false; LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { "action" : "rerender" } ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" } }, } "selector" : "#kudosButtonV2_4", }, { ] { { ] } LITHIUM.AjaxSupport.ComponentEvents.set({ }, LITHIUM.Loader.runJsAttached(); "event" : "expandMessage", } LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2044970}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045283}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045727}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2045935}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046122}},{"elementId":"link_31","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046162}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046183}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046199}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046203}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2046206}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2504044}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492835}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508080}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506436}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2506139}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2510469}},{"elementId":"link_62","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509918}},{"elementId":"link_64","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509847}},{"elementId":"link_66","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509650}},{"elementId":"link_68","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509356}},{"elementId":"link_70","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509159}},{"elementId":"link_73","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2509134}},{"elementId":"link_75","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508860}},{"elementId":"link_77","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508673}},{"elementId":"link_79","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2508534}}]);